You have no items in your shopping cart.
Streptavidin Fluorescein Conjugated
Description
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Purity | This product was prepared from chromatographically pure Streptavidin. Assay by immunoelectrophoresis resulted in a single precipitin arc against anti-Fluorescein and anti-Streptavidin. |
|---|---|
| Conjugation | FITC |
Storage & Handling
−| Storage | Store vial at 4° C prior to restoration. For extended storage aliquot contents and freeze at -20° C or below. Avoid cycles of freezing and thawing. Centrifuge product if not completely clear after standing at room temperature. This product is stable for several weeks at 4° C as an undiluted liquid. Dilute only prior to immediate use. |
|---|---|
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | Preservative: 0.01% (w/v) Sodium Azide. Stabilizer: 10 mg/mL Bovine Serum Albumin (rAlbumin) - Immunoglobulin and Protease free; Buffer: 0.02 M Potassium Phosphate, 0.15 M Sodium Chloride, pH 7.2 |
| Concentration | 1.0 mg/mL |
| Expiration Date | 12 months from date of receipt. |
| Hazard Information | Non-Toxic |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Confirmation of putative receptor-binding sites on the ligands using synthetic analogues by immunocytochemistry. Interaction of synthetic analogues of putative receptor-binding sites with cultured hBMECs. The interaction was detected with streptavidin-FITC conjugate (p/n orb348765). Nuclei are stained with DAPI. rDIII and rNadA (positive control) – whole recombinant ligands were incubated with hBMECs. DIII-1 – GTTYGVCSK-biotin; DIII-2 – VLIELEPPFGDSYIVVGRK-biotin; NadA-1 – AATVAIVAAYNNGQEINGFKAGETIYDIGEDGTITQK-biotin; NadA-2 – LADTDAALADTDAALDETTNALNKLGENITTFAEETK-biotin. Negative control – synthetic peptides were excluded from the assay.

CXCL12 and CCL19 cooperate in cell surface binding and signalling responses selectively in invasive breast cancer cells. (B) Cells were left untreated as (negative control) or were exposed to biotinylated CCL19 alone or in combination with CXCL12 as indicated followed by the addition of FITC-conjugated streptavidin and flow cytometry (FC) analysis. Shown are representative histograms for invasive (MDA-MB-231) and non-invasive (MDA-MB-453) cells (left panel). The increase in FITC MFI in cells treated with the combination of CCL19 and CXCL12 relative to cells treated with CCL19 alone was quantitated for a panel of cell lines and graphed (right panel). FITC-conjugated streptavidin (p/n orb348765). All data shown are mean ± SEM with two-tailed student t-test and are representative of at least two independent experiments. Levels of significance ** p ≤ 0.01, *** p ≤ 0.001, ns—not significant.

Dot Blot of STREPTAVIDIN Fluorescein Conjugated. Lane A: BSA-Biotin. Lane B: BSA. Lanes 1: load 100 ng, 2-5: serial dilution 3 fold. Primary Antibody: n/a Secondary Antibody: Streptavidin Fluorescein Conjugated at 1 mg/ml at RT for 30 minutes. Block: orb348637 at RT for 30 minutes.
Documents Download
Request a Document
Protocol Information
Streptavidin Fluorescein Conjugated (orb348766)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review