Cart summary

You have no items in your shopping cart.

STRBP Rabbit Polyclonal Antibody (FITC)

STRBP Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2124687

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2124687
CategoryAntibodies
DescriptionSTRBP Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human STRBP
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW74kDa
UniProt IDQ96SI9
Protein SequenceSynthetic peptide located within the following region: PSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNS
NCBINP_060857
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesp74, SPNR, ILF3L, HEL162
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.