SRF Rabbit Polyclonal Antibody

• Catalog Number: orb592912
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SRF
• Target: SRF
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SRF
• Protein Sequence: Synthetic peptide located within the following region: ATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIM
• UniProt ID: P11831
• MW: 52kDa
• Tested applications: ChIP, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MCM1
• Note: For research use only
• NCBI: NP_003122

Chromatin Immunoprecipitation (ChIP) Using SRF antibody - N-terminal region (orb592912) and HCT116 Cells.

WB Suggested Anti-SRF Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate. SRF is supported by BioGPS gene expression data to be expressed in Jurkat.