Cart summary

You have no items in your shopping cart.

SRD5A1 Peptide - middle region

SRD5A1 Peptide - middle region

Catalog Number: orb1999227

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1999227
CategoryProteins
DescriptionSRD5A1 Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
MW29 kDa
UniProt IDP18405
Protein SequenceSynthetic peptide located within the following region: GMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYA
NCBINP_001038.1
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
Alternative namesS5AR 1
Read more...
NoteFor research use only
Expiration Date6 months from date of receipt.