SPOP Rabbit Polyclonal Antibody

• Catalog Number: orb581060
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SPOP
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SPOP
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 42kDa
• Target: SPOP
• UniProt ID: O43791
• Protein Sequence: Synthetic peptide located within the following region: YHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
• NCBI: NP_001007227
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TEF2, BTBD32, NSDVS1, NSDVS2, NEDMACE, NEDMIDF
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human MCF7, Antibody dilution: 1.0 ug/ml.

Sample Type: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

WB Suggested Anti-SPOP Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. SPOP is supported by BioGPS gene expression data to be expressed in HepG2.