You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581060 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SPOP |
Target | SPOP |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SPOP |
Protein Sequence | Synthetic peptide located within the following region: YHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS |
UniProt ID | O43791 |
MW | 42kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | TEF2, BTBD32, NSDVS1, NSDVS2, NEDMACE, NEDMIDF |
Note | For research use only |
NCBI | NP_001007227 |
Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human MCF7, Antibody dilution: 1.0 ug/ml.
Sample Type: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
WB Suggested Anti-SPOP Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. SPOP is supported by BioGPS gene expression data to be expressed in HepG2.
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |