Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SOX4 Rabbit Polyclonal Antibody

SKU: orb576583

Description

Rabbit polyclonal antibody to SOX4

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Protein Biochemistry, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SOX4
TargetSOX4
Protein SequenceSynthetic peptide located within the following region: STASTGGKADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNA
Molecular Weight47 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CSS10, EVI16

Similar Products

  • SOX4 Rabbit Polyclonal Antibody [orb158462]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Gallus

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • SOX4 Antibody (N-term) [orb1931763]

    FC,  IF,  IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • SOX4 Antibody (Center) [orb33638]

    IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • SOX4 Rabbit Polyclonal Antibody [orb574573]

    IHC,  WB

    Bovine, Canine, Guinea pig, Mouse, Rabbit

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SOX4 Polyclonal Antibody [orb3150089]

    ELISA,  IHC,  WB

    Frog, Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SOX4 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

SOX4 Rabbit Polyclonal Antibody

Sample Tissue: Human Fetal Stomach, Antibody Dilution: 1.0 ug/ml.

SOX4 Rabbit Polyclonal Antibody

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/ml.

SOX4 Rabbit Polyclonal Antibody

Sample Type: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

SOX4 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

SOX4 Rabbit Polyclonal Antibody

Human Testis

SOX4 Rabbit Polyclonal Antibody

lane 1: Human Testis, primary antibody: SOX4 antibody - N-terminal region (orb576583), primary antibody dilution: 1:1000, secondary antibody: goat anti-rabbit-HRP, secondary antibody dilution: 1:10000, blocking buffer: 3% milk in TBST, Actual Primary Conc (mg/mL): 0.9, Expected Primary Conc (mg/mL): 0.5.

SOX4 Rabbit Polyclonal Antibody

lane 1: Human Testis, primary antibody:SOX4 antibody - N-terminal region (orb576583), primary antibody dilution: 1:1000, secondary antibody: goat anti-rabbit-HRP, secondary antibody dilution: 1:10000, blocking buffer: 3% milk in TBST, Actual Primary Conc (mg/mL): 1.9, Expected Primary Conc (mg/mL): 0.5.

SOX4 Rabbit Polyclonal Antibody

WB Suggested Anti-SOX4 Antibody Titration: 0.2-1 ug/ml. A: - blocking peptide. B: + blocking peptide.

SOX4 Rabbit Polyclonal Antibody

WB Suggested Anti-SOX4 Antibody Titration: 1 ug/ml, Positive Control: Hela cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003098

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SOX4 Rabbit Polyclonal Antibody (orb576583)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry