You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb576583 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SOX4 |
| Target | SOX4 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SOX4 |
| Protein Sequence | Synthetic peptide located within the following region: STASTGGKADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNA |
| UniProt ID | Q06945 |
| MW | 47 kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CSS10, EVI16 |
| Research Area | Cell Biology, Epigenetics & Chromatin, Immunology Read more... |
| Note | For research use only |
| NCBI | NP_003098 |

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Fetal Stomach, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Human Testis

lane 1: Human Testis, primary antibody: SOX4 antibody - N-terminal region (orb576583), primary antibody dilution: 1:1000, secondary antibody: goat anti-rabbit-HRP, secondary antibody dilution: 1:10000, blocking buffer: 3% milk in TBST, Actual Primary Conc (mg/mL): 0.9, Expected Primary Conc (mg/mL): 0.5.

lane 1: Human Testis, primary antibody:SOX4 antibody - N-terminal region (orb576583), primary antibody dilution: 1:1000, secondary antibody: goat anti-rabbit-HRP, secondary antibody dilution: 1:10000, blocking buffer: 3% milk in TBST, Actual Primary Conc (mg/mL): 1.9, Expected Primary Conc (mg/mL): 0.5.

WB Suggested Anti-SOX4 Antibody Titration: 0.2-1 ug/ml. A: - blocking peptide. B: + blocking peptide.

WB Suggested Anti-SOX4 Antibody Titration: 1 ug/ml, Positive Control: Hela cell lysate.
FC, IF, IHC-Fr, IHC-P, WB | |
Gallus | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Guinea pig, Mouse, Rabbit | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF | |
Gallus | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review