Cart summary

You have no items in your shopping cart.

SNRPD3 Peptide - middle region

SNRPD3 Peptide - middle region

Catalog Number: orb2001117

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2001117
CategoryProteins
DescriptionSNRPD3 Peptide - middle region
Tested applicationsWB
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
MW13 kDa
UniProt IDP62318
Protein SequenceSynthetic peptide located within the following region: MLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKR
NCBINP_001265585.1
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
Alternative namesSMD3, Sm-D3
Read more...
NoteFor research use only
Application notesThis is a synthetic peptide designed for use in combination with SNRPD3 Rabbit Polyclonal Antibody (orb589077). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Expiration Date6 months from date of receipt.