Cart summary

You have no items in your shopping cart.

SMIM29 Rabbit Polyclonal Antibody (Biotin)

SMIM29 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2087173

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2087173
CategoryAntibodies
DescriptionSMIM29 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman, Mouse
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human C6orf1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW17kDa
UniProt IDQ86T20
Protein SequenceSynthetic peptide located within the following region: SCSLTWETPRWYMAGRVATSTSGCHCWMSRRDLTPLPHPSEPGVLDCLGP
NCBINP_001008704
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesLBH, C6orf1
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.