C14ORF156 Rabbit Polyclonal Antibody

• Catalog Number: orb577873
• Category: Antibodies
• Description: Rabbit polyclonal antibody to C14ORF156
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C14ORF156
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 12kDa
• Target: SLIRP
• UniProt ID: Q9GZT3
• Protein Sequence: Synthetic peptide located within the following region: PFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQ
• NCBI: NP_112487
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DC50, PD04872, C14orf156
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human HCT15 Whole Cell, Antibody Dilution: 1 ug/ml.

Rabbit Anti-C14ORF156 antibody, Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-SLIRP antibody, Formalin Fixed Paraffin Embedded Tissue: Human Heart, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-SLIRP antibody, Formalin Fixed Paraffin Embedded Tissue: Human Heart, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-C14ORF156 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. SLIRP is supported by BioGPS gene expression data to be expressed in HepG2.