Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

C14ORF156 Rabbit Polyclonal Antibody

SKU: orb577873

Description

C14ORF156 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SLIRP. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human C14ORF156. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Porcine, Rabbit, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Porcine, Rabbit, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human C14ORF156
TargetSLIRP
Protein SequenceSynthetic peptide located within the following region: PFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQ
Molecular Weight12kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

DC50, PD04872, C14orf156

Similar Products

  • SLIRP/C14orf156 Rabbit Polyclonal Antibody [orb313141]

    IF,  IHC-Fr,  IHC-P,  WB

    Porcine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • SLIRP Rabbit Polyclonal Antibody [orb668190]

    IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl, 30 μl
  • SLIRP Rabbit Polyclonal Antibody [orb625230]

    ELISA,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • SLIRP/C14orf156 Rabbit Polyclonal Antibody (HRP) [orb474000]

    IHC-Fr,  IHC-P,  WB

    Porcine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    HRP

    100 μl
  • SLIRP/C14orf156 Rabbit Polyclonal Antibody (Cy3) [orb975604]

    IF

    Porcine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Cy3

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

C14ORF156 Rabbit Polyclonal Antibody

Sample Tissue: Human HCT15 Whole Cell, Antibody Dilution: 1 ug/ml.

C14ORF156 Rabbit Polyclonal Antibody

Rabbit Anti-C14ORF156 antibody, Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

C14ORF156 Rabbit Polyclonal Antibody

Rabbit Anti-SLIRP antibody, Formalin Fixed Paraffin Embedded Tissue: Human Heart, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

C14ORF156 Rabbit Polyclonal Antibody

Rabbit Anti-SLIRP antibody, Formalin Fixed Paraffin Embedded Tissue: Human Heart, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

C14ORF156 Rabbit Polyclonal Antibody

WB Suggested Anti-C14ORF156 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. SLIRP is supported by BioGPS gene expression data to be expressed in HepG2.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_112487

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

C14ORF156 Rabbit Polyclonal Antibody (orb577873)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry