Cart summary

You have no items in your shopping cart.

Slc9a8 Rabbit Polyclonal Antibody (HRP)

Slc9a8 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2119955

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2119955
CategoryAntibodies
DescriptionSlc9a8 Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Rat Slc9a8
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW63kDa
UniProt IDQ4L208
Protein SequenceSynthetic peptide located within the following region: LHKGNFFQNIGSITLFAVFGTAISAFVVGGGIYFLGQADVISKLNMTDSF
NCBINP_001020452
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
NoteFor research use only
Expiration Date12 months from date of receipt.
  • SLC9A8 Rabbit Polyclonal Antibody (HRP) [orb2119952]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    HRP

    100 μl