You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330359 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SLC8B1 |
| Target | SLC8B1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC24A6 |
| Protein Sequence | Synthetic peptide located within the following region: SIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTE |
| UniProt ID | Q6J4K2 |
| MW | 64 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti FLJ22233 antibody, anti NCKX6 antibody, anti Read more... |
| Research Area | Cell Biology, Signal Transduction |
| Note | For research use only |
| NCBI | NP_079235 |
| Expiration Date | 12 months from date of receipt. |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/mL of the antibody was used in this experiment. The canonical isoform of 64 kDa is present as well as a second isoform around 58 kDa.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 5 ug/mL.

Positive control (+): Human Placenta (PL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-SLC24A6 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate.
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Canine, Human, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Canine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Cy5 |
ICC, IF | |
Canine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
APC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review