You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb325125 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SLC46A1 |
| Target | SLC46A1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC46A1 |
| Protein Sequence | Synthetic peptide located within the following region: MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR |
| UniProt ID | Q96NT5 |
| MW | 50 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti HCP1 antibody, anti MGC9564 antibody, anti PC Read more... |
| Research Area | Cell Biology |
| Note | For research use only |
| NCBI | NP_542400 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 2 ug/mL.

WB Suggested Anti-SLC46A1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:2500, Positive Control: OVCAR-3 cell lysate.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Gallus, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF | |
Bovine, Gallus, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
APC |
FC, ICC, IF | |
Bovine, Gallus, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Cy5.5 |
FC, ICC, IF | |
Bovine, Gallus, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
RBITC |
FC, ICC, IF | |
Bovine, Gallus, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Cy7 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review