You have no items in your shopping cart.
Cart summary
SLC3A2 Peptide - middle region
Catalog Number: orb2001531
| Catalog Number | orb2001531 |
|---|---|
| Category | Proteins |
| Description | SLC3A2 Peptide - middle region |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 68 kDa |
| UniProt ID | P08195 |
| Protein Sequence | Synthetic peptide located within the following region: DFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWL |
| NCBI | NP_001012680.1 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | 4F2, CD98, MDU1, 4F2HC, 4T2HC, NACAE, CD98HC Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
