SLC37A4 Rabbit Polyclonal Antibody

• Catalog Number: orb578942
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC37A4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC37A4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46 kDa
• Target: SLC37A4
• UniProt ID: O43826
• Protein Sequence: Synthetic peptide located within the following region: VSFLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWV
• NCBI: NP_001458
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: G6PT1, G6PT2, G6PT3, GSD1b, GSD1c, GSD1d, TRG19, T
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 46 kDa isoform is identified, and a second isoform of 48 kDa is also present in some samples.

Sample Type: Human Fetal Kidney, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-SLC37A4 Antibody, Catalog Number: orb578942, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, weak signal, low tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SLC37A4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: OVCAR-3 cell lysate. SLC37A4 is supported by BioGPS gene expression data to be expressed in OVCAR3.