Cart summary

You have no items in your shopping cart.

    SLC37A3 Antibody - middle region : HRP

    SLC37A3 Antibody - middle region : HRP

    Catalog Number: orb2119772

    DispatchUsually dispatched within 5-10 working days
    $ 632.00
    Catalog Numberorb2119772
    CategoryAntibodies
    DescriptionSLC37A3 Antibody - middle region : HRP
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsIHC, WB
    ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC37A3
    Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
    ConjugationHRP
    MW54kDa
    UniProt IDQ8NCC5
    Protein SequenceSynthetic peptide located within the following region: FFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDS
    NCBINP_996996
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
    Alternative namesSPX3
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars