Slc36a4 Rabbit Polyclonal Antibody

SKU: orb325126

Description

Rabbit polyclonal antibody to Slc36a4

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Slc36a4
• Target: Slc36a4
• Protein Sequence: Synthetic peptide located within the following region: RPLINEQNFDGSSDEEQEQTLVPIQKHYQLDGQHGISFLQTLVHLLKGNI
• Molecular Weight: 56 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti 6330573I15Rik antibody, anti PAT4 antibody

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/mL.

Quick Database Links

Gene Symbol

Slc36a4

UniProt

Q8CH36

RefSeq (Protein):NP_758493