You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325126 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Slc36a4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Slc36a4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56 kDa |
Target | Slc36a4 |
UniProt ID | Q8CH36 |
Protein Sequence | Synthetic peptide located within the following region: RPLINEQNFDGSSDEEQEQTLVPIQKHYQLDGQHGISFLQTLVHLLKGNI |
NCBI | NP_758493 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti 6330573I15Rik antibody, anti PAT4 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/mL.
WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |