You have no items in your shopping cart.
Cart summary
Slc34a1 Peptide - N-terminal region
Catalog Number: orb2003747
Product Properties
| Catalog Number | orb2003747 |
|---|---|
| Category | Proteins |
| Description | Slc34a1 Peptide - N-terminal region |
| Predicted Reactivity | Human, Rat |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: YVPSPQVLHRIPGTTTYAISSLSPVALTEHSCPYGEVLECHDPLPAKLAQ |
| UniProt ID | Q9Z323 |
| MW | 37kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with SLC34A1 Rabbit Polyclonal Antibody (orb578958). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Note | For research use only |
Images
Reviews
Slc34a1 Peptide - N-terminal region (orb2003747)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review