SLC33A1 Rabbit Polyclonal Antibody

• Catalog Number: orb578976
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC33A1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC33A1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 61 kDa
• Target: SLC33A1
• UniProt ID: O00400
• Protein Sequence: Synthetic peptide located within the following region: CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG
• NCBI: NP_004724
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: AT1, AT-1, ACATN, SPG42, CCHLND
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide sequence is also contained within a 29 kDa isoform of the protein.

Sample Type: Hela, Antibody Dilution: 1.0 ug/ml. SLC33A1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 2 ug/ml.

Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. SLC33A1 is supported by BioGPS gene expression data to be expressed in 721_B.

Positive control (+): Human Placenta (PL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

Rabbit Anti-SLC33A1 Antibody, Catalog Number: orb578976, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Membrane, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-SLC33A1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adult Small intestine, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-SLC33A1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Placenta.

WB Suggested Anti-SLC33A1 antibody Titration: 1 ug/ml, Sample Type: Human heart.

WB Suggested Anti-SLC33A1 antibody Titration: 1 ug/ml, Sample Type: Human liver.