You have no items in your shopping cart.
Cart summary
SLC2A4 Peptide - C-terminal region
Catalog Number: orb2001532
| Catalog Number | orb2001532 |
|---|---|
| Category | Proteins |
| Description | SLC2A4 Peptide - C-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: FFIFTFLRVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND |
| UniProt ID | P14672 |
| MW | 55 kDa |
| Tested applications | WB |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | GLUT4 |
| Note | For research use only |
| NCBI | NP_001033.1 |
