Cart summary

You have no items in your shopping cart.

SLC25A22 Rabbit Polyclonal Antibody (Biotin)

SLC25A22 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2119816

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2119816
CategoryAntibodies
DescriptionSLC25A22 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Guinea pig, Human, Mouse, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A22
Protein SequenceSynthetic peptide located within the following region: VNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV
UniProt IDQ9H936
MW34kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesGC1, DEE3, GC-1, EIEE3, NET44
NoteFor research use only
NCBINP_078974
  • SLC25A22 Rabbit Polyclonal Antibody (Biotin) [orb2119813]

    IHC,  WB

    Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

    Rabbit

    Polyclonal

    Biotin

    100 μl