You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216257 |
---|---|
Category | Proteins |
Description | The Ovine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ovine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Ovine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Ovine IL-6 Specifications: (Molecular Weight: 20.4 kDa) (Amino Acid Sequence: GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK (179)) (Gene ID: 443406). |
Target | IL-6 |
Form/Appearance | Lyophilized |
Purity | 98% |
Protein Sequence | GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK (179) |
Protein Length | 179 |
MW | 20.4 kDa |
Source | Yeast |
Biological Origin | Ovine |
Storage | -20°C |
Note | For research use only |
Greater than 90% as determined by SDS-PAGE. | |
47.5 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
22.5 kDa | |
Yeast |