You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2001908 |
---|---|
Category | Proteins |
Description | SH3BGRL3 Peptide - N-terminal region |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
MW | 10kDa |
UniProt ID | Q9H299 |
Protein Sequence | Synthetic peptide located within the following region: STSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNP |
NCBI | NP_112576 |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Buffer/Preservatives | Lyophilized powder |
Alternative names | TIP-B1, SH3BP-1, HEL-S-297 Read more... |
Note | For research use only |
Application notes | This is a synthetic peptide designed for use in combination with SH3BGRL3 Rabbit Polyclonal Antibody (orb327407). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
Expiration Date | 6 months from date of receipt. |