SFKEELDKYFKNHTSP

• Catalog Number: orb1140628
• Category: Proteins
• Description: Epitope from the S2 protein of SARS-CoV-2; Peptides.
• Form/Appearance: Freeze dried solid
• Purity: > 95% by hplc
• MW: 1970.16 Da
• Formula: C₉₀ H₁₃₂N₂₂O₂₈
• Structure: H-Ser-Phe-Lys-Glu-Glu-Leu-Asp-Lys-Tyr-Phe-Lys-Asn-His-Thr-Ser-Pro-OH
• Solubility (25°C): Soluble in water
• Protein Sequence: SFKEELDKYFKNHTSP
• Storage: Store dry, frozen and in the dark
• Alternative names: 1147SFKEELDKYFKNHTSP1162, 1147SFKEELDKYFKNHTSP1162
• Background: SFKEELDKYFKNHTSP is a truncated peptide derived from the P4 peptide of the S2 subunit of the S protein of SARS-CoV-2 which has the the amino acid sequence DPLQPELDSFKEELDKYFKNHTSPDVDLGDIS, corresponding to residues 1139-1170. The P4 peptide is located in the linker regionbetween heptad repeat 1 (HR1) and heptad repeat 2 (HR2) and is highly conserved among SARS-CoV, BatCoV RaTG13,SARS-CoV-2 and recent SARS-CoV-2 variants. Antibodies targeting the peptide SFKEELDKYFKNHTSP can neutralize both SARS-CoV-2 and SARS-CoV by preventing fusion between the virus and the cell membrane.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.