Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 protein

• Catalog Number: orb668871
• Category: Proteins
• Description: Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9(nsp9) protein
• Tag: C-terminal hFc-Flag-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Purity: Greater than 90% as determined by SDS-PAGE.
• MW: 44.5 kDa
• UniProt ID: P0DTD1
• Protein Sequence: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
• Protein Length: Full length
• Source: Mammalian cell
• Biological Origin: Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV)
• Expression Region: 1-113aa
• Endotoxins: Not test.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Alternative names: Non-structural protein 9
• Note: For research use only
• Application notes: Coronavirus-Host Interactome Targets Proteins
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The purity of nsp9 was greater than 95% as determined by SEC-HPLC