SETDB2 Rabbit Polyclonal Antibody

SKU: orb330572

Description

SETDB2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SETDB2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human SETDB2. This antibody reacts with Human samples and is predicted to react with Guinea pig, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Guinea pig, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SETDB2
• Target: SETDB2
• Protein Sequence: Synthetic peptide located within the following region: ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTGNKE
• Molecular Weight: 77kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CLLD8 antibody, anti CLLL8 antibody, anti KMT1F antibody, anti C13orf4 antibody

Quick Database Links

Gene Symbol

SETDB2

UniProt

Q96T68

RefSeq:AAH47434