You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330572 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SETDB2 |
Target | SETDB2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Guinea pig, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SETDB2 |
Protein Sequence | Synthetic peptide located within the following region: ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTGNKE |
UniProt ID | Q96T68 |
MW | 77kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti CLLD8 antibody, anti CLLL8 antibody, anti KMT Read more... |
Note | For research use only |
NCBI | AAH47434 |
WB Suggested Anti-SETDB2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |