SEMA7A Rabbit Polyclonal Antibody

• Catalog Number: orb585945
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SEMA7A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEMA7A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 68kDa
• Target: SEMA7A
• UniProt ID: O75326
• Protein Sequence: Synthetic peptide located within the following region: SIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPME
• NCBI: NP_003603
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: JMH, CD108, SEMAL, CDw108, SEMAK1, H-Sema-L, H-SEM
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. SEMA7A is supported by BioGPS gene expression data to be expressed in 721_B.

Positive control (+): HepG2 cell lysate (HG), Negative control (-): A549 cell lysate (N03), Antibody concentration: 3 ug/ml.

WB Suggested Anti-SEMA7A Antibody, Titration: 1.0 ug/ml, Positive Control: MDA-MB-435S Whole Cell. SEMA7A is supported by BioGPS gene expression data to be expressed in MDA-MB435.