You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585945 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SEMA7A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEMA7A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 68kDa |
Target | SEMA7A |
UniProt ID | O75326 |
Protein Sequence | Synthetic peptide located within the following region: SIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPME |
NCBI | NP_003603 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | JMH, CD108, SEMAL, CDw108, SEMAK1, H-Sema-L, H-SEM Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. SEMA7A is supported by BioGPS gene expression data to be expressed in 721_B.
Positive control (+): HepG2 cell lysate (HG), Negative control (-): A549 cell lysate (N03), Antibody concentration: 3 ug/ml.
WB Suggested Anti-SEMA7A Antibody, Titration: 1.0 ug/ml, Positive Control: MDA-MB-435S Whole Cell. SEMA7A is supported by BioGPS gene expression data to be expressed in MDA-MB435.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Biotin |