Sema3f antibody

Catalog Number: orb326109

Catalog Number	orb326109
Category	Antibodies
Description	Rabbit polyclonal antibody to Sema3f
Species/Host	Rabbit
Clonality	Polyclonal
Tested applications	IHC, IP, WB
Predicted Reactivity	Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Reactivity	Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
Immunogen	The immunogen is a synthetic peptide corresponding to a region of Mouse
Concentration	0.5 mg/ml
Form/Appearance	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
MW	83kDa
Target	Sema3f
UniProt ID	O88632
Protein Sequence	Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH
NCBI	NP_035479
Storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Alternative names	anti Sema4 antibody, anti Semak antibody Read more...
Note	For research use only
Expiration Date	12 months from date of receipt.

Western blot analysis of HEK293 cells tissue using Sema3f antibody

Immunohistochemical staining of HEK293 cell tissue using Sema3f antibody

Western blot analysis of HEK293F tissue using Sema3f antibody

Western blot analysis of mouse Liver tissue using Sema3f antibody