Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Sema3f Rabbit Polyclonal Antibody

SKU: orb326109

Description

Sema3f Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Sema3f. It is suitable for IHC, IP, WB applications. The immunogen is a synthetic peptide corresponding to a region of Mouse. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, IP, WB
ReactivityMouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
TargetSema3f
Protein SequenceSynthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH
Molecular Weight83kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti Sema4 antibody, anti Semak antibody

Similar Products

  • Semaphorin 3F Rabbit Polyclonal Antibody [orb11360]

    ICC,  IF,  IHC-Fr,  IHC-P

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • SEMA3F rabbit pAb Antibody [orb770020]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Semaphorin 3F Rabbit Polyclonal Antibody (HRP) [orb475025]

    IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Human, Porcine, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl
  • Semaphorin 3F Rabbit Polyclonal Antibody [orb499823]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Human, Porcine, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Semaphorin 3F Rabbit Polyclonal Antibody [orb500694]

    WB

    Bovine, Canine, Gallus, Human, Porcine, Rabbit, Rat, Sheep

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sema3f Rabbit Polyclonal Antibody

Application: IP, Species+tissue/cell type:1.5 mL conditioned media from HEK293F cells transfected with 1: Sema 3F_AP, 2: Sema3C_FLAG, 3: UntransfectedAmount of IP Antibody: Amount of IP Antibody: 5 ug, Primary antibody Dilution: 1:1000, Secondary antibody: Goat Anti-rabbit HRP, Secondary antibody Dilution: 1:10000.

Sema3f Rabbit Polyclonal Antibody

Sample Type: Untransfected HEK293 and Sema3F-AP transfected HEK293, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti rabbit-Alexa Fluor 488, Secondary Antibody Dilution: 1:500, Gene Name: SEMA3F.

Sema3f Rabbit Polyclonal Antibody

WB Suggested Anti-SEMA3F Antibody, Positive Control: Lane 1: No transfection, Lane 2: cell lysates from HEK293 cells were transfected with alkaline phosphatase (AP-) tagged Sema3F, Lane 3: AP-alone, Lane 4: The cell media from cells transfected with AP-Sema3F, Primary Antibody Dilution: 1 ug/mL, Secondary Antibody: Anti-AP, Secondry Antibody Dilution: 1:1000.

Sema3f Rabbit Polyclonal Antibody

WB Suggested Anti-Sema3f Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_035479

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol
IP
Immunoprecipitation
View Protocol

Sema3f Rabbit Polyclonal Antibody (orb326109)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry