You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb55683 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SEP15 . |
Target | SELENOF |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Mouse, Porcine, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SEP15 |
Protein Sequence | Synthetic peptide located within the following region: SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS |
UniProt ID | O60613 |
MW | 15kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | 45184 |
Research Area | Signal Transduction, Stem Cell & Developmental Bio Read more... |
Note | For research use only |
NCBI | NP_004252 |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-SEP15 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
WB | |
Bovine, Human, Mouse, Porcine, Zebrafish | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Human, Mouse, Porcine, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Human, Mouse, Porcine, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Human, Mouse, Porcine, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Biotin |