Cart summary

You have no items in your shopping cart.

SCT Peptide - middle region

SCT Peptide - middle region

Catalog Number: orb1997779

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1997779
CategoryProteins
DescriptionSCT Peptide - middle region
Predicted ReactivityRat
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: SFVLPAPPRTPRHSDGTFTSELSRLQDSARLQRLLQGLVGKRSEEDTENI
UniProt IDP11384
MW15 kDa
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesSecr
NoteFor research use only
NCBINP_073161