Cart summary

You have no items in your shopping cart.

Scara3 Rabbit Polyclonal Antibody (HRP)

Scara3 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2115968

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2115968
CategoryAntibodies
DescriptionScara3 Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein SequenceSynthetic peptide located within the following region: KTIQTTLGASSQRISQNSESMHDLVLQVMGLQLQLDNISSFLDDHEENMH
UniProt IDQ8C850
MW65kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesCSR, APC7, CSR1, MSLR1, MSRL1, C130058N24Rik
NoteFor research use only
NCBINP_766192
  • SCARA3 Rabbit Polyclonal Antibody (HRP) [orb472571]

    IHC-Fr,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl