Cart summary

You have no items in your shopping cart.

SCAND2 Rabbit Polyclonal Antibody (FITC)

SCAND2 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2100411

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2100411
CategoryAntibodies
DescriptionSCAND2 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityEquine, Human
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SCAND2
Protein SequenceSynthetic peptide located within the following region: IQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL
UniProt IDA8K374
MW18kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesSCAND2
NoteFor research use only
NCBINP_378666