You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326511 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SBF1 |
Target | SBF1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: YLEPTEDLAPAQEVGEAPSQEDERSALDVASEQRRLWPTLSREKQQELVQ |
UniProt ID | O95248 |
MW | 91kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti C22:RP4-579N16.2 antibody, anti MTMR5 antibod Read more... |
Note | For research use only |
NCBI | CAH18463 |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-SBF1 Antibody, Titration: 1.0 ug/mL, Positive Control: 293T Whole Cell, SBF1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |