You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576574 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SATB1 |
Target | SATB1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SATB1 |
Protein Sequence | Synthetic peptide located within the following region: VDVAEYKEEELLKDLEESVQDKNTNTLFSVKLEEELSVEGNTDINTDLKD |
UniProt ID | Q01826 |
MW | 86 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | DEFDA, KTZSL |
Note | For research use only |
NCBI | NP_002962 |
Positive control (+): 293T (2T), Negative control (-): A549 (N03), Antibody concentration: 3 ug/ml.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide is present in 3 isoforms including 89 kDa, 86 kDa, and 78 kDa. The protein may be modified by phosphorylation and/or sumoylation.
Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 0.625 ug/ml, Peptide Concentration: 1.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 6%-18%. SATB1 is supported by BioGPS gene expression data to be expressed in Jurkat.
WB Suggested Anti-SATB1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate. SATB1 is supported by BioGPS gene expression data to be expressed in Jurkat.
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Gallus, Porcine, Rabbit | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |