Availability
- Request Lead Time
- In stock and ready for quick dispatch
- Usually dispatched within 5-10 working days
Shipping Destination:
United StatesShipping charges:
Freight/Packing: $34.00Product Overview
Product Name | SARS MERS protein |
---|---|
Catalog Number | orb428303 |
Conjugation | Unconjugated |
Target | SARS MERS |
Product Properties
Form/Appearance | Sterile filtered clear solution. SARS MERS protein solution is supplied in PBS, 25mM arginine and 0.05% sodium azide. |
---|---|
Storage | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
Note | For research use only. |
Protein Sequence | EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH. |
Purity | >95% pure as determined by 12% PAGE (coomassie staining). |
Source | Escherichia Coli. |
Product Description
Recombinant of SARS MERS protein
Reviews
Write Your Own Review