You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1272800 |
---|---|
Category | Antibodies |
Description | SARS-CoV-2 (COVID-19) ORF8 protein polyclonal antibody |
Clonality | Polyclonal |
Isotype | IgG |
Conjugation | Unconjugated |
Reactivity | Virus |
Form/Appearance | Liquid |
Concentration | batch dependent |
Buffer/Preservatives | PBS, pH 7.4, containing 0.05% proclin300, 50% glycerol. |
Immunogen | MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
Tested applications | ELISA |
Application notes | Elisa:1:4000~1:8000 |
Antibody Type | Primary Antibody |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | Non-structural protein 8,ns8,ORF8 protein |
Note | For research use only |