SARS-CoV-2 (COVID-19) ORF7a protein polyclonal antibody

• Catalog Number: orb1272801
• Category: Antibodies
• Description: SARS-CoV-2 (COVID-19) ORF7a protein polyclonal antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA
• Reactivity: Virus
• Isotype: IgG
• Immunogen: MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE
• Concentration: batch dependent
• Dilution range: Elisa:1:4000~1:8000
• Form/Appearance: Liquid
• Conjugation: Unconjugated
• Storage: Use a manual defrost freezer and avoid repeated freeze thaw cycles. Store at 2 to 8 °C for one week. Store at -20 to -80 °C for twelve months from the date of receipt.
• Buffer/Preservatives: PBS, pH 7.4, containing 0.05% proclin300, 50% glycerol.
• Alternative names: Accessory protein 7a,Protein U122,Protein X4,ORF7a
• Note: For research use only
• Application notes: Elisa:1:4000~1:8000
• Expiration Date: 12 months from date of receipt.