You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1272801 |
---|---|
Category | Antibodies |
Description | SARS-CoV-2 (COVID-19) ORF7a protein polyclonal antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ELISA |
Reactivity | Virus |
Isotype | IgG |
Immunogen | MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE |
Concentration | batch dependent |
Dilution range | Elisa:1:4000~1:8000 |
Form/Appearance | Liquid |
Conjugation | Unconjugated |
Storage | Use a manual defrost freezer and avoid repeated freeze thaw cycles. Store at 2 to 8 °C for one week. Store at -20 to -80 °C for twelve months from the date of receipt. |
Buffer/Preservatives | PBS, pH 7.4, containing 0.05% proclin300, 50% glycerol. |
Alternative names | Accessory protein 7a,Protein U122,Protein X4,ORF7a Read more... |
Note | For research use only |
Application notes | Elisa:1:4000~1:8000 |
Expiration Date | 12 months from date of receipt. |
Filter by Rating