You have no items in your shopping cart.
Cart summary
Item 1 of 1
SARS-CoV-2 (COVID-19) NTD Recombinant Protein
Catalog Number: orb1231619
| Catalog Number | orb1231619 |
|---|---|
| Category | Proteins |
| Description | SARS-CoV-2 (COVID-19) NTD Recombinant Protein |
| Tested applications | ELISA |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid |
| Purity | > 95% by SDS Page |
| MW | The predicted molecular mass is ~36 kDa. |
| Protein Sequence | VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGT KRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCND PFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNID GYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAG AAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKS |
| Source | HEK293 cells |
| NCBI | QHD43416.1 |
| Storage | This recombinant protein may be stored as received at 2-8˚°C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at -80˚°C. Avoid Repeated Freeze Thaw Cycles. |
| Buffer/Preservatives | This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added. |
| Note | For research use only |
| Application notes | ELISA |
| Expiration Date | 6 months from date of receipt. |
Purified SARS-CoV-2 N-Terminal Domain (NTD) Spike Protein under non-reducing conditions. Lane 1-NTD Protein loaded at 10 μg.
- Item 1 of 2
SARS-CoV-2 (COVID-19) S1 Recombinant Protein NTD [orb1231454]
ELISA, WB
> 90% as determined by SDS-PAGE.
34.9 kDa
HEK293 cells
0.1 mg - Item 1 of 2
- Item 1 of 1
SARS-CoV-2 (2019-nCoV) S1 protein NTD, His Tag [orb689470]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 33.7 kDa after removal of the signal peptide. The apparent molecular mass of S1-NTD-His is approximately 55 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
SARS-CoV-2 (2019-nCoV) S1 protein NTD, mFc Tag [orb689471]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 59.1 kDa after removal of the signal peptide.The apparent molecular mass of S1-NTD-mFc is approximately 70-100 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg - Item 1 of 1
SARS-CoV-2 (2019-nCoV) S1 protein NTD, hFc Tag [orb689472]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 59.0 kDa after removal of the signal peptide. The apparent molecular mass of S1-NTD-hFc is approximately 70-100 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg
