You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1231619 |
---|---|
Category | Proteins |
Description | SARS-CoV-2 (COVID-19) NTD Recombinant Protein |
Tested applications | ELISA |
Concentration | 0.5 mg/ml |
Dilution range | ELISA |
Form/Appearance | Liquid |
Purity | > 95% by SDS Page |
MW | The predicted molecular mass is ~36 kDa. |
Protein Sequence | VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGT KRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCND PFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNID GYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAG AAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKS |
Source | HEK293 cells |
NCBI | QHD43416.1 |
Storage | This recombinant protein may be stored as received at 2-8°C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at -80°C. Avoid Repeated Freeze Thaw Cycles. |
Buffer/Preservatives | This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added. |
Note | For research use only |
Application notes | ELISA |
Expiration Date | 6 months from date of receipt. |
Purified SARS-CoV-2 N-Terminal Domain (NTD) Spike Protein under non-reducing conditions. Lane 1-NTD Protein loaded at 10 μg.
ELISA, WB | |
> 90% as determined by SDS-PAGE. | |
34.9 kDa | |
HEK293 cells |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 33.7 kDa after removal of the signal peptide. The apparent molecular mass of S1-NTD-His is approximately 55 kDa due to glycosylation. | |
Mammalian |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 59.1 kDa after removal of the signal peptide.The apparent molecular mass of S1-NTD-mFc is approximately 70-100 kDa due to glycosylation. | |
Mammalian |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 59.0 kDa after removal of the signal peptide. The apparent molecular mass of S1-NTD-hFc is approximately 70-100 kDa due to glycosylation. | |
Mammalian |
Filter by Rating