SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag

Catalog Number: orb669263

Catalog Number	orb669263
Category	Proteins
Description	SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag is produced in E. coli and the theoretical molecular weight is 22.7KD.
Reactivity	Mouse
Form/Appearance	Lyophilized
MW	22.7KD
Protein Sequence	AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
Source	E. coli
Endotoxins	Less than 1 EU/μg protein as determined by LAL method.
Storage	The product is shipped at ambient temperature. Upon receipt, store it immediately at -20°C for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Alternative names	SARS-CoV-2, COVID-19, 2019-nCov, coronavirus, NSP8 Read more...
Note	For research use only
Expiration Date	6 months from date of receipt.