SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag

• Catalog Number: orb669263
• Category: Proteins
• Description: SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag is produced in E. coli and the theoretical molecular weight is 22.7KD.
• Reactivity: Mouse
• Form/Appearance: Lyophilized
• Purification: > 90%. Purification measurement method by SDS-PAGE quantitative densitometry by Coomassie? Blue Staining.Method of purification: Nickel column affinity purification
• Protein Sequence: AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
• MW: 22.7KD
• Endotoxins: Less than 1 EU/μg protein as determined by LAL method.
• Source: E. coli
• Storage: The product is shipped at ambient temperature. Upon receipt, store it immediately at -20°C for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Alternative names: SARS-CoV-2, COVID-19, 2019-nCov, coronavirus, NSP8
• Note: For research use only
• Expiration Date: 6 months from date of receipt.