RYMV P1 Antibody

SKU: orb334975

Description

Goat polyclonal antibody to P1 protein from rice yellow mottle virus (RYMV). P1 protein is a product from the gene ORF1. This protein has a possible role in suppression of post-transcriptional gene silencing and viral movement.

Images & Validation

• Tested Applications: WB
• Dilution range: WB:1:500-1:2,000
• Reactivity: Virus
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 55 aa to N-terminal of RYMV P1 produced in E. coli.. Antigen Sequence: MTRLEVLIRPTEQTVAKAIAVGYTHTLTWVWYPQTWDVDSVNDPVLRADFDPDRAG
• Target: RYMV P1
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Disclaimer: For research use only

Alternative Names

P1 (ORF1), RYMV, Rice Yellow Mottle Virus antibody.

Western blot analysis of staining of MBP-RYMV P1 N-term recombinant protein and HEK293 transfected cell lysate using RYMV P1 antibody

Quick Database Links

Gene Symbol

RYMV P1