You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330430 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RXRB |
Target | RXRB |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RXRB |
Protein Sequence | Synthetic peptide located within the following region: MHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSG |
UniProt ID | P28702 |
MW | 57kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti DAUDI6 antibody, anti H-2RIIBP antibody, anti Read more... |
Note | For research use only |
NCBI | NP_068811 |
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.
WB Suggested Anti-RXRB Antibody Titration: 0.2-1 ug/mL, Positive Control: Human brain.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Porcine, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |