RWDD3 Rabbit Polyclonal Antibody

SKU: orb584315

Description

Rabbit polyclonal antibody to RWDD3

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine, Guinea pig, Mouse, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: RWDD3
• Protein Sequence: Synthetic peptide located within the following region: ESLLSEPMVHELVLWIQQNLRHILSQPETGSGSEKCTFSTSTTMDDGLWI
• Molecular Weight: 30kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

RSUME

Positive control (+): Human kidney (KI), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

WB Suggested Anti-RWDD3 Antibody, Titration: 1.0 ug/ml, Positive Control: 293T Whole Cell. RWDD3 is supported by BioGPS gene expression data to be expressed in HEK293T.

Quick Database Links

Gene Symbol

RWDD3

UniProt

Q9Y3V2

RefSeq (Protein):NP_056300