RWDD3 Rabbit Polyclonal Antibody

• Catalog Number: orb584315
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RWDD3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 30kDa
• Target: RWDD3
• UniProt ID: Q9Y3V2
• Protein Sequence: Synthetic peptide located within the following region: ESLLSEPMVHELVLWIQQNLRHILSQPETGSGSEKCTFSTSTTMDDGLWI
• NCBI: NP_056300
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RSUME
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): Human kidney (KI), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

WB Suggested Anti-RWDD3 Antibody, Titration: 1.0 ug/ml, Positive Control: 293T Whole Cell. RWDD3 is supported by BioGPS gene expression data to be expressed in HEK293T.