You have no items in your shopping cart.
Cart summary
Rrp7a Peptide - C-terminal region
Catalog Number: orb2006137
| Catalog Number | orb2006137 |
|---|---|
| Category | Proteins |
| Description | Rrp7a Peptide - C-terminal region |
| Predicted Reactivity | Human, Rat |
| Form/Appearance | Lyophilized powder |
| MW | 30kDa |
| UniProt ID | NM_001130568 |
| Protein Sequence | KERRKRARKELLSFYAWQHRETKMEHLAQLRKKFEEDKQRIELMRAQRKF |
| NCBI | D4AE65 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | Cgi-96, RGD1311547 Read more... |
| Note | For research use only |
| Application notes | This is a synthetic peptide designed for use in combination with Rrp7a Rabbit Polyclonal Antibody (orb577788). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Expiration Date | 6 months from date of receipt. |
