You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586169 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RPL15 |
Target | RPL15 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: SALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGK |
UniProt ID | P61313 |
MW | 24 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | L15, EC45, DBA12, RPL10, RPLY10, RPYL10 |
Note | For research use only |
NCBI | NP_002939 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 3 ug/ml.
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 3 ug/ml.
Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 3 ug/ml.
Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 3 ug/ml.
WB Suggested Anti-RPL15 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |