Cart summary

You have no items in your shopping cart.

RP11-298P3.3 Rabbit Polyclonal Antibody (FITC)

RP11-298P3.3 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2105088

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2105088
CategoryAntibodies
DescriptionRP11-298P3.3 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityCanine, Equine, Human, Porcine
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RP11-298P3.3
Protein SequenceSynthetic peptide located within the following region: EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN
UniProt IDQ92802
MW87kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesCG005, CG016, PFAAP5, 92M18.3
NoteFor research use only
NCBINP_149102