RNF135 Rabbit Polyclonal Antibody

• Catalog Number: orb575178
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RNF135
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNF135
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 48kDa
• Target: RNF135
• UniProt ID: Q8IUD6
• Protein Sequence: Synthetic peptide located within the following region: DILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPAL
• NCBI: NP_115698
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: L13, MMFD, REUL, Riplet
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 3 ug/ml.

Positive control (+): Human Placenta (PL), Negative control (-): HeLa (HL), Antibody concentration: 1 ug/ml.

WB Suggested Anti-RNF135 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.