RIN3 Rabbit Polyclonal Antibody

SKU: orb575168

Description

Rabbit polyclonal antibody to RIN3

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RIN3
• Target: RIN3
• Protein Sequence: Synthetic peptide located within the following region: AGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEEKSILYLEGSAL
• Molecular Weight: 108kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

WB Suggested Anti-RIN3 Antibody Titration: 5.0 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate, There is BioGPS gene expression data showing that RIN3 is expressed in HepG2.

Quick Database Links

Gene Symbol

RIN3

UniProt

Q76LB3

RefSeq (Protein):NP_079108