You have no items in your shopping cart.
Cart summary
Item 1 of 1
RIN3 Rabbit Polyclonal Antibody
Catalog Number: orb575168
Product Properties
| Catalog Number | orb575168 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to RIN3 |
| Target | RIN3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RIN3 |
| Protein Sequence | Synthetic peptide located within the following region: AGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEEKSILYLEGSAL |
| UniProt ID | Q76LB3 |
| MW | 108kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Research Area | Cell Biology, Epigenetics & Chromatin, Immunology Read more... |
| Note | For research use only |
| NCBI | NP_079108 |
Images
WB Suggested Anti-RIN3 Antibody Titration: 5.0 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate, There is BioGPS gene expression data showing that RIN3 is expressed in HepG2.
Similar Products
- Item 1 of 3
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Reviews
RIN3 Rabbit Polyclonal Antibody (orb575168)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review