RHOT2 Rabbit Polyclonal Antibody

• Catalog Number: orb585301
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RHOT2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RHOT2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 67kDa
• Target: RHOT2
• UniProt ID: Q8IXI1
• Protein Sequence: Synthetic peptide located within the following region: TIPADVTPEKVPTHIVDYSEAEQTDEELREEIHKANVVCVVYDVSEEATI
• NCBI: NP_620124
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RASL, ARHT2, MIRO2, MIRO-2, C16orf39
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-RHOT2 Antibody, Positive Control: Lane 1: 20 ug untransfected HEK293T, Lane 2: 20 ug RHOT2 transfected HEK293T, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody dilution: 1:2000.