You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330590 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RHBG |
Target | RHBG |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RHBG |
Protein Sequence | Synthetic peptide located within the following region: LATHEAYGDGLESVFPLIAEGQRSATSQAMHQLFGLFVTLMFASVGGGLG |
UniProt ID | Q9H310 |
MW | 47kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti SLC42A2 antibody |
Note | For research use only |
NCBI | NP_065140 |
Anti-RHBG antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. RHBG Antibody orb330590 concentration 5 ug/ml.
WB Suggested Anti-RHBG Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate, RHBG is supported by BioGPS gene expression data to be expressed in HepG2.
WB | |
Bovine, Human, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Human, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Biotin |
WB | |
Bovine, Human, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
AP |