Cart summary

You have no items in your shopping cart.

RETREG2 Rabbit Polyclonal Antibody (FITC)

RETREG2 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2112567

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2112567
CategoryAntibodies
DescriptionRETREG2 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FAM134A
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW58kDa
UniProt IDQ8NC44
Protein SequenceSynthetic peptide located within the following region: AGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVCS
NCBINP_077269
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesMAG-2, C2orf17, FAM134A
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.