REG1A Rabbit Polyclonal Antibody

• Catalog Number: orb585675
• Category: Antibodies
• Description: Rabbit polyclonal antibody to REG1A
• Target: REG1A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: SLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN
• UniProt ID: P05451
• MW: 16kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: P19, PSP, PTP, REG, ICRF, PSPS, PSPS1
• Note: For research use only
• NCBI: NP_002900

Sample Type: Fetal Liver, Antibody dilution: 1.0 ug/ml.